PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK25203.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family TALE
Protein Properties Length: 739aa    MW: 82527.7 Da    PI: 6.8711
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK25203.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.4e-084594961954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  PK25203.1 459 FEHflHPYPSDVDKVILARQTGLSRSQVSNWFINARVR 496
                554459******************************88 PP

2BELL120.48.2e-39318389172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                e++elqk+k+kLls+leeV++rYk+y++q+++v+ssFeavag g+a++Y +lA+ka+SrhFrcLkd i++qi
  PK25203.1 318 EFMELQKRKTKLLSMLEEVERRYKHYCDQMKAVVSSFEAVAGAGAATVYSALASKAMSRHFRCLKDGIVNQI 389
                679********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-57249387IPR006563POX domain
PfamPF075264.2E-47255385IPR006563POX domain
PROSITE profilePS5007112.131437500IPR001356Homeobox domain
SMARTSM003892.0E-9440504IPR001356Homeobox domain
CDDcd000863.56E-11440501No hitNo description
SuperFamilySSF466896.42E-17441506IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-27443506IPR009057Homeodomain-like
PfamPF059201.7E-17457496IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MVSSAGFCYS DVSPNNNNIP SSTTAPNHIQ PQFTNNHQIQ EFHHHSNPAE IFNLTTGMEM  60
IGFSKTSNNQ SFSTISKAAA GPSSSKTMDE STNTNHHDQN QDHDHHHHQF YDHFTTGISE  120
TSCENLMVGP DHDHQQQPWQ ENRFLVDDSS LRCVFPCEGN ERPSQGLSLS LSSANPSSIG  180
LQSFELRQTN HHHQQHQDHH DDDHMRFLST SSRDGYFGKV ANMQTTQQMN MNHNQDGFLG  240
GNKAVNFHHQ VQFQLKNSKY LNPTRELLNE FCSLGTKQTD LITKQKSQKL SKQTSWDDQT  300
ADNNGASSSK NKSLYSLEFM ELQKRKTKLL SMLEEVERRY KHYCDQMKAV VSSFEAVAGA  360
GAATVYSALA SKAMSRHFRC LKDGIVNQIQ ATRKAMGEKD ATGGAPGTTR GETPRLRLLD  420
QTLRQQRAFQ QMTMMESHPW RPQRGLPERS VSVLRAWLFE HFLHPYPSDV DKVILARQTG  480
LSRSQVSNWF INARVRLWKP MVEEMYLEET KERELANMGA SSSSPDHDQL DNILGDPIRL  540
SGRSNPPDTE QKPTHDQLLR IDSECLSSIV INPEKSPHHG HNNMIHQIRH QNFGGGSRFG  600
EVVSFGSSSS QQELDFSSYN NNNNNQQQQR NGGGSVLYSN HDHQNPSNVA GFNNGGGVSL  660
TLGLQQHAGG GGGGGHGGGV SLAFSHPGSQ SSVFYSSRDH NIDDDQCQQG VVQYSLLDGE  720
GQNLPYRNLM GAQLLHDLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-15446504563Homeobox protein Meis2
3k2a_B4e-15446504563Homeobox protein Meis2
4xrs_A3e-15446503158Homeobox protein Meis1
4xrs_B3e-15446503158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007040322.10.0POX family protein isoform 1
RefseqXP_007040323.10.0POX family protein isoform 1
RefseqXP_007040324.10.0POX family protein isoform 1
RefseqXP_007040325.10.0POX family protein isoform 1
RefseqXP_007040326.10.0POX family protein isoform 1
TrEMBLA0A061G6K40.0A0A061G6K4_THECC; POX family protein isoform 1
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-120TALE family protein